YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name
Parathyroïd Hormone(1-34), bovine

Alias
 

Catalog No.
15364

CAS No.
 

Sequence

Ala-Val-Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-
Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-
Gln-Asp-Val-His-Asn-Phe

Sequence
(One letter code)


AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF

Molecular Formula
C183H288N54O50S2
Molecular Weight

4108.7
Purity (HPLC)

>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP