YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

Neuropeptide K, porcine

Alias
 

Catalog No.
15328

CAS No.
[90880-35-6]

Sequence
H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-
Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr
-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2

Sequence
(One letter code)
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Molecular Formula
C189H285N55O57S1

Molecular Weight
4271.78

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP