YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

Helodormin

Alias
 

Catalog No.
15236

CAS No.
 

Sequence


His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-
Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-NH2

Sequence
(One letter code)

HSDAIFTQYSKLLAKLALQKYLASILGSRTSPPP-NH2

Molecular Formula
C176H285N47O49

Molecular Weight
3843.47

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP