YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

Helodermin

Alias
 

Catalog No.
15235

CAS No.
 

Sequence

H-His-Ser-Asp-Ala-Ile-Phe-Thr-Glu-Glu-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-
Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-NH2

Sequence
(One letter code)

HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP-NH2

Molecular Formula
C176H283N45O51

Molecular Weight
3845.49

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP