YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

Glucagon-Like Peptide I (7-37), GLP-1 (7-37)

Alias
GLP-I; GLPI; GLP-1; GLP1; GCG peptide; Glucagon-Like PeptideI; Glucagon-Like Peptide 1; Glucagon-Like Peptide1

Catalog No.
15220

CAS No.
 

Sequence
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-
Arg-Gly-OH

Sequence
(One letter code)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Molecular Formula
C151H226N40O46

Molecular Weight
3337.73

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP