YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

GHRF, bovine

Alias

Growth Hormone Releasing Factor, bovine

Catalog No.
15209

CAS No.

[88894-91-1]

Sequence

H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-G-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-
Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-
Lys-Val-Arg-Leu-NH2

Sequence
(One letter code)

YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Molecular Formula

C220H366N72O66S1

Molecular Weight
5107.88

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP