YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

GHRF (1-44), human

Alias

Growth Hormone Releasing Factor

Catalog No.
15208

CAS No.

[83930-13-6]

Sequence

H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-
Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met
-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-
Arg-Ala-Arg-Leu-NH2

Sequence
(One letter code)

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Molecular
Formula

C215H358N72O66S1

Molecular Weight
5039.7

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP