YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

VIP, guinea pig

Alias
VIP

Catalog No.

15480

CAS No.
 

Sequence

H-His-Ser-Asp-Ala-Leu-Phe-Thr-Asp-Thr-Tyr-Thr-Arg-Leu-
Arg-Lys-Gln-Met-Ala-Met-Lys-Lys-Tyr-Leu-Asn-Ser-Val-Leu
-Asn-NH2

Sequence
(One letter code)


HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2

Molecular Formula
C147H239N43O42S2

Molecular Weight

3344.93
Purity (HPLC)

>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP