YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

Urodilatin CCC/ANP-95-126

Alias
 

Catalog No.
15469

CAS No.
 

Sequence
Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-
Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-
Ser-Phe-Arg-Tyr

(Disulfide bridge: Cys11- Cys27)

Sequence
(One letter code)
TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY

(Disulfide bridge: Cys11- Cys27)

Molecular Formula
C145H234N52O44S3

Molecular Weight

3506.0
Purity (HPLC)

>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP