YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

Urocortin II, mouse

Alias
UrocortinII; Urocortin 2; UCN IIUCN2

Catalog No.
15466

CAS No.
 

Sequence
H-Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-
Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala
-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH2

Sequence
(One letter code)
VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2

Molecular Formula
C187H320N56O50

Molecular Weight

4152.98
Purity (HPLC)

>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP