YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

Stresscopin, human

Alias
 

Catalog No.
15428

CAS No.
[352020-03-2]
Sequence
H-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2

Sequence
(One letter code)

TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2

Molecular Formula
C195H326N56O53S2

Molecular Weight

4367.24
Purity (HPLC)

>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP