YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name
Pancreastatin, porcine

Alias
 

Catalog No.
15361

CAS No.
 

Sequence

Gly-Trp-Pro-Gln-Ala-Pro-Ala-Met-Asp-Gly-Ala-Gly-Lys-Thr-
Gly-Ala-Glu-Glu-Ala-Gln-Pro-Pro-Glu-Gly-Lys-Gly-Ala-Arg-
Glu-His-Ser-Arg-Gln-Glu-Glu-Glu-Glu-Glu-Thr-Ala-Gly-Ala-
Pro-Gln-Gly-Leu-Phe-Arg-Gly-NH2

Sequence
(One letter code)

GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2

Molecular
Formula
C214H330N68O76S
Molecular Weight
5103.4

Purity (HPLC)

>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP