YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name
Pancreatic Polypeptide, human

Alias
PP

Catalog No.
15360

CAS No.
[75976-10-2]

Sequence

H-Gly-Pro-Ser-Gln-Pro-Thr-Tyr-Pro-Gly-Asp-Asp-Ala-Pro-
Val-Glu-Asp-Leu-Ile-Arg-Phe-Tyr-Asp-Asn-Leu-Gln-Gln-Tyr
-Leu-Asn-Val-Val-Thr-Arg-His-Arg-Tyr-NH2

Sequence
(One letter code)

GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2

Molecular Formula

C190H283N53O58
Molecular Weight

4237.69

Purity (HPLC)

>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP