YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name
Pancreatic Polypeptide, human

Alias
PP

Catalog No.
15359

CAS No.
[75976-10-2]

Sequence

H-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-
Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-
Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2

Sequence
(One letter code)

APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2

Molecular Formula
C185H287N53O54S2
Molecular Weight

4181.8

Purity (HPLC)

>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP