YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

PACAP (6-38), human, ovine, rat

Alias
 

Catalog No.
15354

CAS No.
 

Sequence

His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-
Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-
Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2

Sequence
(One letter code)
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2

Molecular Formula
C203H331N63O65S
Molecular Weight

4534.4

Purity (HPLC)

>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP