YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

PACAP (1-27), human, ovine, rat

Alias
 

Catalog No.

15353

CAS No.
[127317-03-7]

Sequence

H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg
-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2

Sequence
(One letter code)
HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2

Molecular Formula
C142H224N40O39S1
Molecular Weight

3147.68

Purity (HPLC)

>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP