YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name
PACAP 38, frog

Alias
 

Catalog No.

15352

CAS No.
[137061-48-4]

Sequence

H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg
-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-
Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Ile-Lys-Asn-Lys-NH2

Sequence
(One letter code)
HSDGIFTDSRYRKQMAVKKYLAAVLGKRYKQRIKNK-NH2

Molecular Formula
C204H333N63O53S
Molecular Weight

4548.38

Purity (HPLC)

>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP