YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

Neuropeptide Y (3-36), human

Alias
 

Catalog No.
15329

CAS No.
[150138-78-6]

Sequence

H-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-
Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-
Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2

Sequence
(One letter code)
SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Molecular Formula
C175H269N53O54S1

Molecular Weight
4011.48

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP