YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

Neuropeptide K, porcine

Alias
 

Catalog No.
15327

CAS No.
 

Sequence
H-Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-
Lys-Ala-Leu-Tyr-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-
Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2

Sequence
(One letter code)
DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2

Molecular Formula
C175H284N52O52S1

Molecular Weight
5980.6

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP