YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name
Glucagon-Like Peptide II, rat

Alias

GLP-2; GLP2; GLP-II; GLPII

Catalog No.
15222

CAS No.
 

Sequence
H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH

Sequence
(One letter code)
HADGSFSDEMNTILDNLATRDFINWLIQTKITD

Molecular Formula
C166H256N44O56S1

Molecular Weight
3796.22

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP