YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name
Glucagon-Like Peptide II, human

Alias
Glucagon-Like PeptideII; Glucagon-Like Peptide 2; Glucagon-Like Peptide2; GLP II; GLPII; GLP 2; GLP2

Catalog No.
15221

CAS No.

[99120-49-7]

Sequence
H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH

Sequence
(One letter code)
HADGSFSDEMNTILDNLAARDFINWLIQTKITD

Molecular Formula
C171H266N48O56S1

Molecular Weight
3922.38

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP