YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

Glucagon (19-29), human

Alias
GLP-I; GLPI; GLP-1; GLP1; GLP-1 (7-36), amide, human, Glucagon Like PeptideI; Glucagon Like Peptide 1; Glucagon Like
Peptide1;

Catalog No.
15219

CAS No.

[107444-51-9]

Sequence
H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Sequence
(One letter code)

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Molecular Formula
C149H229N40O45

Molecular Weight
3297.7

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP