YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

GHRF, rat

Alias

Growth Hormone Releasing Factor, rat

Catalog No.
15212

CAS No.
 

Sequence

H-His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-
Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Arg-Ser-Arg-Phe-
Asn-OH

Sequence
(One letter code)

HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN

Molecular Formula

C225H361N77O66S1

Molecular Weight
5232.93

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP