YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

GHRF, ovine

Alias

Growth Hormone Releasing Factor, ovine

Catalog No.
15211

CAS No.
 

Sequence

H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Ile-Leu
-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-
Leu-NH2

Sequence
(One letter code)

YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Molecular Formula

C221H368N72O66S1

Molecular Weight
5121.9

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP