YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

GHRF, mouse

Alias

Growth Hormone Releasing Factor, mouse

Catalog No.
15210

CAS No.
 

Sequence

H-His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser-OH

Sequence
(One letter code)

HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS

Molecular Formula

C220H365N69O64S1

Molecular Weight
5032.85

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP