YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

Gastrin Releasing Peptide, porcine

Alias

GRP

Catalog No.
15207

CAS No.

[16941-32-5]

Sequence

Ala-Pro-Val-Ser-Val-Gly-Gly-Gly-Thr-Val-Leu-Ala-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2

Sequence
(One letter code)

APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2

Molecular Formula

C126H198N38O31S2

Molecular Weight
2805.40

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP