YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

Gastric Inhibitory Peptide (GIP), human

Alias
 

Catalog No.
15202

CAS No.

[100040-31-1]

Sequence

H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-
Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-
Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-
Gln-OH

Sequence
(One letter code)

YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Molecular Formula

C226H338N60O66S1

Molecular Weight
4983.64

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP