YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

Galanin, rat

Alias
 

Catalog No.
15200

CAS No.

[114547-31-8]

Sequence

Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-
Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-
Thr-NH2

Sequence
(One letter code)

GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2

Molecular Formula
C141H211N43O41

Molecular Weight
3164.48

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP