YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name
b-Endorphin, human

Alias
 

Catalog No.
15171

CAS No.
[61214-51-5]
Sequence

H-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-
Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-
Lys-Lys-Gly-Glu-OH

Sequence
(One letter code)

YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Molecular Formula

C158H251N39O46S1

Molecular Weight
3465.06

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP