YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

Calcitonin, eel

Alias
Thyrocalcitonin

Catalog No.
150102

CAS No.

[21215-62-3]

Sequence
H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2

Disulfide bridge: Cys1-Cys7

Sequence
(One letter code)

CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2

Molecular Formula

C151H226N40O45S3

Molecular Weight
3417.87

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP