YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name

BNP (1-32), human

Alias

Brain Natriuretic Peptide(1-32), human

Catalog No.
15075

CAS No.
[114471-18-0]

Sequence

H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg- Lys-
Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-
Val-Leu-Arg-Arg-His-OH

Disulfide Bridge: Cys10-Cys26

Sequence
(One letter code)
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Molecular Formula
C143H244N50O42S4

Molecular Weight

3464.1

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP