YOUR COMANY NAME HERE
ACES Pharma, Inc

Product Name
Adrenomedullin (22-52), human

Alias
 

Catalog No.
15023

CAS No.
 
Sequence
H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2

Sequence
(One letter code)
TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Molecular Formula


C159H252N46O48

Molecular Weight

3576.06

Purity (HPLC)
>95%

Notes
For laboratory use only. Not for drugs, household or other uses


Alphabetical Search for Catalog Peptides
AP